Sphingosine kinase 1 (Sphingosine kinase 1, isoform CRA_c)

UniProt : Q96GK1, UniProt ID: Q96GK1_HUMAN,

Sphingosine kinase 1 (Sphingosine kinase 1, isoform CRA_c)

Homo sapiens

MDPVVGCGRGLFGFVFSAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAE
ISFTLMLTERRNHARELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLC
SLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSV
LSLAWGFIADVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASP
VVVQQGPVDAHLVPLEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMH
LFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMV
SEAVQGQVHPNYFWMVSGCVEPPPSWKPQQMPPPEEPL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sphingosine kinase 1 (Sphingosine kinase 1, isoform CRA_c) contains a PF00781 domain.

Sphingosine kinase 1 (Sphingosine kinase 1, isoform CRA_c) is proteolytically cut by cathepsin B (C01.060) cleavage..