Betacellulin, epidermal growth factor family member

UniProt : Q05928, Q543J8, UniProt ID: BTC_MOUSE, Q543J8_MOUSE,

Betacellulin, epidermal growth factor family member

Mus musculus

MDPTAPGSSVSSLPLLLVLALGLAILHCVVADGNTTRTPETNGSLCGAPGENCTGTTPRQ
KVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFYLQQDRGQIL
VVCLIVVMVVFIILVIGVCTCCHPLRKHRKKKKEEKMETLDKDKTPISEDIQETNIA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Betacellulin, epidermal growth factor family member contains a PF00008 domain.

Betacellulin, epidermal growth factor family member is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..

Betacellulin, epidermal growth factor family member is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. DLFY-LQQD.