Aging-associated protein 2 (Suppression of tumorigenicity 13 (Colon carcinoma) (Hsp70 interacting protein), isoform CRA_a) (Suppression of tumorigenicity 13) (Colon carcinoma) (Hsp70 interacting protein)

UniProt : P50502, Q2TU77, UniProt ID: F10A1_HUMAN, Q2TU77_HUMAN,

Aging-associated protein 2 (Suppression of tumorigenicity 13 (Colon carcinoma) (Hsp70 interacting protein), isoform CRA_a) (Suppression of tumorigenicity 13) (Colon carcinoma) (Hsp70 interacting protein)

Homo sapiens

MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKP
DSKKVEEDLKADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVA
AIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPD
SAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER
KREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGSFPGGFPGGMPGNFPGGMPGM
GGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISK
LSAKFGGQA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Aging-associated protein 2 (Suppression of tumorigenicity 13 (Colon carcinoma) (Hsp70 interacting protein), isoform CRA_a) (Suppression of tumorigenicity 13) (Colon carcinoma) (Hsp70 interacting protein) contains a PF00515 domain.

Aging-associated protein 2 (Suppression of tumorigenicity 13 (Colon carcinoma) (Hsp70 interacting protein), isoform CRA_a) (Suppression of tumorigenicity 13) (Colon carcinoma) (Hsp70 interacting protein) contains a PF00515 domain.

Aging-associated protein 2 (Suppression of tumorigenicity 13 (Colon carcinoma) (Hsp70 interacting protein), isoform CRA_a) (Suppression of tumorigenicity 13) (Colon carcinoma) (Hsp70 interacting protein) contains a PF07719 domain.

Aging-associated protein 2 (Suppression of tumorigenicity 13 (Colon carcinoma) (Hsp70 interacting protein), isoform CRA_a) (Suppression of tumorigenicity 13) (Colon carcinoma) (Hsp70 interacting protein) is proteolytically cut by thrombin (S01.217) cleavage. VQPR-AQKI.