Natriuretic peptide B (Natriuretic peptide B, isoform CRA_a)

UniProt : B0ZBE9, P16860, UniProt ID: ANFB_HUMAN, B0ZBE9_HUMAN,

Natriuretic peptide B (Natriuretic peptide B, isoform CRA_a)

Homo sapiens

MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE
QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI
SSSSGLGCKVLRRH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Natriuretic peptide B (Natriuretic peptide B, isoform CRA_a) contains a PF00212 domain.

Natriuretic peptide B (Natriuretic peptide B, isoform CRA_a) is proteolytically cut by furin (S08.071) cleavage. RAPR-SPKM.