Isoform 2 of Tumor necrosis factor ligand superfamily member 11

UniProt : O14788, Q54A98, UniProt ID: O14788-2, Q54A98_HUMAN,

Isoform 2 of Tumor necrosis factor ligand superfamily member 11

Homo sapiens

MDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQH
IVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGW
AKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSH
TLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKV
RDID

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Tumor necrosis factor ligand superfamily member 11 contains a PF00229 domain.

Isoform 2 of Tumor necrosis factor ligand superfamily member 11 is proteolytically cut by ADAM33 peptidase (C14.003) cleavage. GSQH-IRAE.