Tumor necrosis factor (Ligand) superfamily, member 8 (Tumor necrosis factor (Ligand) superfamily, member 8, isoform CRA_b) (cDNA, FLJ94189, Homo sapiens tumor necrosis factor (ligand) superfamily, member 8(TNFSF8), mRNA)

UniProt : P32971, Q52M88, UniProt ID: Q52M88_HUMAN, TNFL8_HUMAN,

Tumor necrosis factor (Ligand) superfamily, member 8 (Tumor necrosis factor (Ligand) superfamily, member 8, isoform CRA_b) (cDNA, FLJ94189, Homo sapiens tumor necrosis factor (ligand) superfamily, member 8(TNFSF8), mRNA)

Homo sapiens

MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVL
VVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGI
LHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESG
MQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tumor necrosis factor (Ligand) superfamily, member 8 (Tumor necrosis factor (Ligand) superfamily, member 8, isoform CRA_b) (cDNA, FLJ94189, Homo sapiens tumor necrosis factor (ligand) superfamily, member 8(TNFSF8), mRNA) contains a PF00229 domain.

Tumor necrosis factor (Ligand) superfamily, member 8 (Tumor necrosis factor (Ligand) superfamily, member 8, isoform CRA_b) (cDNA, FLJ94189, Homo sapiens tumor necrosis factor (ligand) superfamily, member 8(TNFSF8), mRNA) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..

Tumor necrosis factor (Ligand) superfamily, member 8 (Tumor necrosis factor (Ligand) superfamily, member 8, isoform CRA_b) (cDNA, FLJ94189, Homo sapiens tumor necrosis factor (ligand) superfamily, member 8(TNFSF8), mRNA) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..