Tissue factor pathway inhibitor 2 (Tissue factor pathway inhibitor 2, isoform CRA_d) (cDNA, FLJ93769, Homo sapiens tissue factor pathway inhibitor 2 (TFPI2), mRNA)

UniProt : P48307, Q66ME8, UniProt ID: Q66ME8_HUMAN, TFPI2_HUMAN,

Tissue factor pathway inhibitor 2 (Tissue factor pathway inhibitor 2, isoform CRA_d) (cDNA, FLJ93769, Homo sapiens tissue factor pathway inhibitor 2 (TFPI2), mRNA)

Homo sapiens

MDPARPLGLSILLLFLTEAALGDAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQS
CRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSM
TCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRY
RTCDAFTYTGCGGNDNNFVSREDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tissue factor pathway inhibitor 2 (Tissue factor pathway inhibitor 2, isoform CRA_d) (cDNA, FLJ93769, Homo sapiens tissue factor pathway inhibitor 2 (TFPI2), mRNA) contains a PF00014 domain.

Tissue factor pathway inhibitor 2 (Tissue factor pathway inhibitor 2, isoform CRA_d) (cDNA, FLJ93769, Homo sapiens tissue factor pathway inhibitor 2 (TFPI2), mRNA) contains a PF00014 domain.

Tissue factor pathway inhibitor 2 (Tissue factor pathway inhibitor 2, isoform CRA_d) (cDNA, FLJ93769, Homo sapiens tissue factor pathway inhibitor 2 (TFPI2), mRNA) contains a PF00014 domain.

Tissue factor pathway inhibitor 2 (Tissue factor pathway inhibitor 2, isoform CRA_d) (cDNA, FLJ93769, Homo sapiens tissue factor pathway inhibitor 2 (TFPI2), mRNA) is proteolytically cut by ADAMTS1 peptidase (M12.222) cleavage..