cDNA FLJ78349, highly similar to Homo sapiens N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mRNA (N-ethylmaleimide-sensitive factor attachment protein, alpha, isoform CRA_c)
UniProt : A8K879, P54920, UniProt ID: A8K879_HUMAN, SNAA_HUMAN, cDNA FLJ78349, highly similar to Homo sapiens N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mRNA (N-ethylmaleimide-sensitive factor attachment protein, alpha, isoform CRA_c) Homo sapiens MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSA AGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIA AKHHISIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQK AIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRE CKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
cDNA FLJ78349, highly similar to Homo sapiens N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mRNA (N-ethylmaleimide-sensitive factor attachment protein, alpha, isoform CRA_c) contains a PF02071 domain.
cDNA FLJ78349, highly similar to Homo sapiens N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mRNA (N-ethylmaleimide-sensitive factor attachment protein, alpha, isoform CRA_c) contains a PF02071 domain.
cDNA FLJ78349, highly similar to Homo sapiens N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mRNA (N-ethylmaleimide-sensitive factor attachment protein, alpha, isoform CRA_c) contains a PF02071 domain.
cDNA FLJ78349, highly similar to Homo sapiens N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mRNA (N-ethylmaleimide-sensitive factor attachment protein, alpha, isoform CRA_c) contains a PF02071 domain.
cDNA FLJ78349, highly similar to Homo sapiens N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mRNA (N-ethylmaleimide-sensitive factor attachment protein, alpha, isoform CRA_c) is proteolytically cut by calpain-2 (C02.002) cleavage..