PMAP: SubstrateDB : cDNA FLJ78349, highly similar to Homo sapiens N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mRNA (N-ethylmaleimide-sensitive factor attachment protein, alpha, isoform CRA

cDNA FLJ78349, highly similar to Homo sapiens N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mRNA (N-ethylmaleimide-sensitive factor attachment protein, alpha, isoform CRA_c)

UniProt : A8K879, P54920, UniProt ID: A8K879_HUMAN, SNAA_HUMAN,

cDNA FLJ78349, highly similar to Homo sapiens N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mRNA (N-ethylmaleimide-sensitive factor attachment protein, alpha, isoform CRA_c)

Homo sapiens

MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSA
AGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIA
AKHHISIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQK
AIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRE
CKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

cDNA FLJ78349, highly similar to Homo sapiens N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mRNA (N-ethylmaleimide-sensitive factor attachment protein, alpha, isoform CRA_c) contains a PF02071 domain.