Synaptosomal-associated protein

UniProt : A8K287, O00161, UniProt ID: A8K287_HUMAN, SNP23_HUMAN,

Synaptosomal-associated protein

Homo sapiens

MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLD
QINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPG
PVTNGQLQQPTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQ
NPQIKRITDKADTNRDRIDIANARAKKLIDS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Synaptosomal-associated protein contains a PF00835 domain.

Synaptosomal-associated protein contains a PF05739 domain.

Synaptosomal-associated protein is proteolytically cut by calpain-1 (C02.001) cleavage..