cDNA FLJ75921, highly similar to Homo sapiens acid phosphatase 5, tartrate resistant (ACP5), mRNA

UniProt : A8K3V2, P13686, UniProt ID: A8K3V2_HUMAN, PPA5_HUMAN,

cDNA FLJ75921, highly similar to Homo sapiens acid phosphatase 5, tartrate resistant (ACP5), mRNA

Homo sapiens

MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQI
LGADFILSLGDNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ
IAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKL
ARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLRPLLATYGVTAYLCGH
DHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVEISSK
EMTVTYIEASGKSLFKTRLPRRARP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ75921, highly similar to Homo sapiens acid phosphatase 5, tartrate resistant (ACP5), mRNA contains a PF00149 domain.

cDNA FLJ75921, highly similar to Homo sapiens acid phosphatase 5, tartrate resistant (ACP5), mRNA is proteolytically cut by trypsin () cleavage. ERPR-DVKL.

cDNA FLJ75921, highly similar to Homo sapiens acid phosphatase 5, tartrate resistant (ACP5), mRNA is proteolytically cut by trypsin () cleavage. RDVK-LART.

cDNA FLJ75921, highly similar to Homo sapiens acid phosphatase 5, tartrate resistant (ACP5), mRNA is proteolytically cut by trypsin () cleavage. QPER-PRDV.