cDNA, FLJ94333, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member B (ANP32B), mRNA (Acidic (Leucine-rich) nuclear phosphoprotein 32 family, member B, isoform CRA_b)

UniProt : B2R9C7, Q92688, UniProt ID: AN32B_HUMAN, B2R9C7_HUMAN,

cDNA, FLJ94333, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member B (ANP32B), mRNA (Acidic (Leucine-rich) nuclear phosphoprotein 32 family, member B, isoform CRA_b)

Homo sapiens

MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNL
PKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDL
FNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQEAPDSDAEVDGVDEEEEDEEGEDEEDE
DDEDGEEEEFDEEDDEDEDVEGDEDDDEVSEEEEEFGLDEEDEDEDEDEEEEEGGKGEKR
KRETDDEGEDD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ94333, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member B (ANP32B), mRNA (Acidic (Leucine-rich) nuclear phosphoprotein 32 family, member B, isoform CRA_b) contains a PF00560 domain.

cDNA, FLJ94333, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member B (ANP32B), mRNA (Acidic (Leucine-rich) nuclear phosphoprotein 32 family, member B, isoform CRA_b) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. DEED-EDED.