Growth hormone receptor

UniProt : P19941, UniProt ID: GHR_RABIT,

Growth hormone receptor

Oryctolagus cuniculus

MDLWQLLLTVALAGSSDAFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPE
LETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTS
IWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPN
ADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKY
GEFSEVLYVTLPQMSPFTCEEDFRFPWFLIIIFGIFGLTVMLFVFIFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIQDSYKPEFYNDDSWVEFIELDIDDPDEKTEGS
DTDRLLSNSHQKSLSVLAAKDDDSGRTSCYEPDILENDFNASDGCDGNSEVAQPQRLKGE
ADLLCLDQKNQNNSPYHDVSPAAQQPEVVLAEEDKPRPLLTGEIESTLQAAPSQLSNPNS
LANIDFYAQVSDITPAGSVVLSPGQKNKAGNSQCDAHPEVVSLCQTNFIMDNAYFCEADA
KKCIAVAPHVDVESRVEPSFNQEDIYITTESLTTTAERSGTAEDAPGSEMPVPDYTSIHL
VQSPQGLVLNAATLPLPDKEFLSSCGYVSTDQLNKILP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Growth hormone receptor contains a PF00041 domain.

Growth hormone receptor is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. QMSP-FTCE.

Growth hormone receptor is proteolytically cut by presenilin 1 (A22.001) cleavage..