LOC397747 protein

UniProt : Q6DE77, UniProt ID: Q6DE77_XENLA,

LOC397747 protein

Xenopus laevis

MDLSPSLLLMLWTLLSVLVEEITGQKVYTNTWAAHISGGSAEADRLCKKYGFINHGLIFE
DHYHFSHRAVMKRSLTPKRTRQVLLKREPQVHWLEQQVAKKRKKRDIYTDPTDPKFMQQW
YLLDTNRHDLHVKEAWEQGFTGKGIVVSILDDGIEKNHPDLQANYDPAASYDVNDQDPDP
QPRYTQLNDNRHGTRCAGEVAAVANNGICGVGIAYNANIGGVRMLDGEVTDAVEARSLGL
NPNHIHIYSASWGPEDDGKTVDGPAKLAEEAFYRGVTQGRGGLGSIYVWASGNGGREHDS
CNCDGYTNSIYTLSISSTTQMGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTD
SHTGTSASAPLAAGIIALALEANKNLTWRDMQHLVVQTSNPAGLNANDWITNGVGRKVSH
SYGYGLLDAGAMVAMAKTWVTVGPQRKYVIDILSEPKDIGKRLEVRRKVEPCAGMSNYIS
TLEHVQARLSLSYNCRGDLAIYLTSPMGTRSCLLAPRPHDYSADGFNDWSFMTTHSWDED
PAGEWVLEIENVSNNNNYGTLTQFVLVLYGTASEGLSRKFDGDGSRNVASSQSCIVCEEG
YFLHQKSCIKSCPQGFTSSIQNIHYTLDNNIEPLLVNVCVPCHVSCATCKGTTINDCLTC
PAHSHYNLLDYSCTHQTQRSRESPTLKDSSHDYVARTSNLPFIVAILSCLFIIVVFGSIF
LFLQLRSGGVLGRKRLYMLDSGIISYKGIPSGAWQEEGFSESETEETAAHSERTAFLKQQ
STL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

LOC397747 protein contains a PF00082 domain.

LOC397747 protein contains a PF01483 domain.

LOC397747 protein is proteolytically cut by furin (S08.071) cleavage. RKKR-DIYT.