ATP-binding cassette, sub-family B (MDR/TAP), member 1 (ATP-binding cassette, sub-family B (MDR/TAP), member 1, isoform CRA_c) (Multidrug resistance protein 1)

UniProt : A4D1D2, UniProt ID: A4D1D2_HUMAN,

ATP-binding cassette, sub-family B (MDR/TAP), member 1 (ATP-binding cassette, sub-family B (MDR/TAP), member 1, isoform CRA_c) (Multidrug resistance protein 1)

Homo sapiens

MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII
HGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSG
IGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS
KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT
DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG
AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG
AAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF
ATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA
IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG
FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRS
SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII
NGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTFGKA
GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA
IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG
AYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS
YSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV
QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV
SQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD
EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL
LAQKGIYFSMVSVQAGTKRQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

ATP-binding cassette, sub-family B (MDR/TAP), member 1 (ATP-binding cassette, sub-family B (MDR/TAP), member 1, isoform CRA_c) (Multidrug resistance protein 1) contains a PF00005 domain.

ATP-binding cassette, sub-family B (MDR/TAP), member 1 (ATP-binding cassette, sub-family B (MDR/TAP), member 1, isoform CRA_c) (Multidrug resistance protein 1) contains a PF00664 domain.

ATP-binding cassette, sub-family B (MDR/TAP), member 1 (ATP-binding cassette, sub-family B (MDR/TAP), member 1, isoform CRA_c) (Multidrug resistance protein 1) contains a PF00664 domain.

ATP-binding cassette, sub-family B (MDR/TAP), member 1 (ATP-binding cassette, sub-family B (MDR/TAP), member 1, isoform CRA_c) (Multidrug resistance protein 1) contains a PF00005 domain.

ATP-binding cassette, sub-family B (MDR/TAP), member 1 (ATP-binding cassette, sub-family B (MDR/TAP), member 1, isoform CRA_c) (Multidrug resistance protein 1) is proteolytically cut by caspase-3 (C14.003) cleavage..