Alpha-crystallin B chain

UniProt : P02511, UniProt ID: CRYAB_HUMAN,

Alpha-crystallin B chain

Homo sapiens

MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW
FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Alpha-crystallin B chain contains a PF00525 domain.

Alpha-crystallin B chain contains a PF00011 domain.

Alpha-crystallin B chain is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. PFFP-FHSP.

Alpha-crystallin B chain is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. SPFY-LRPP.

Alpha-crystallin B chain is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. SPSR-LFDQ.

Alpha-crystallin B chain is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. PPSF-LRAP.

Alpha-crystallin B chain is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. APSW-FDTG.

Alpha-crystallin B chain is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. SPEE-LKVK.

Alpha-crystallin B chain is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. DPLT-ITSS.

Alpha-crystallin B chain is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPRK-QVSG.