cDNA FLJ45309 fis, clone BRHIP3004725, highly similar to DNA-binding protein SATB1 (Special AT-rich sequence binding protein 1 (Binds to nuclear matrix/scaffold-associating DNA's), isoform CRA_a)

UniProt : B3KXF1, Q01826, UniProt ID: B3KXF1_HUMAN, SATB1_HUMAN,

cDNA FLJ45309 fis, clone BRHIP3004725, highly similar to DNA-binding protein SATB1 (Special AT-rich sequence binding protein 1 (Binds to nuclear matrix/scaffold-associating DNA's), isoform CRA_a)

Homo sapiens

MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHS
GHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGY
SHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLP
PEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWY
KHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRTPL
PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKP
LEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ
SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIA
TERNGKPENNTMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSP
ENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQQQQQQQQ
QQQQQQQAPPPPQPQQQPQTGPRLPPRQPTVASPAESDEENRQKTRPRTKISVEALGILQ
SFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYLKHHGKLKDNSGLEVDVAEYK
EEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ45309 fis, clone BRHIP3004725, highly similar to DNA-binding protein SATB1 (Special AT-rich sequence binding protein 1 (Binds to nuclear matrix/scaffold-associating DNA's), isoform CRA_a) contains a PF02376 domain.

cDNA FLJ45309 fis, clone BRHIP3004725, highly similar to DNA-binding protein SATB1 (Special AT-rich sequence binding protein 1 (Binds to nuclear matrix/scaffold-associating DNA's), isoform CRA_a) contains a PF00046 domain.

cDNA FLJ45309 fis, clone BRHIP3004725, highly similar to DNA-binding protein SATB1 (Special AT-rich sequence binding protein 1 (Binds to nuclear matrix/scaffold-associating DNA's), isoform CRA_a) contains a PF02376 domain.

cDNA FLJ45309 fis, clone BRHIP3004725, highly similar to DNA-binding protein SATB1 (Special AT-rich sequence binding protein 1 (Binds to nuclear matrix/scaffold-associating DNA's), isoform CRA_a) is proteolytically cut by caspase-6 (C14.005) cleavage. VEMD-SLSE.