REN protein (Renin)

UniProt : P00797, Q6FI38, UniProt ID: Q6FI38_HUMAN, RENI_HUMAN,

REN protein (Renin)

Homo sapiens

MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

REN protein (Renin) contains a PF00026 domain.

REN protein (Renin) contains a PF07966 domain.

REN protein (Renin) is proteolytically cut by cathepsin B (C01.060) cleavage. PMKR-LTLG.

REN protein (Renin) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. PMKR-LTLG.

REN protein (Renin) is proteolytically cut by cathepsin B (C01.060) cleavage. PMKR-LTLG.

REN protein (Renin) is proteolytically cut by proprotein convertase 5 (S08.076) cleavage. PMKR-LTLG.

REN protein (Renin) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. PMKR-LTLG.

REN protein (Renin) is proteolytically cut by coagulation factor XIIa (S01.211) cleavage. PMKR-LTLG.

REN protein (Renin) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. PMKR-LTLG.

REN protein (Renin) is proteolytically cut by cathepsin B (C01.060) cleavage. PMKR-LTLG.