cDNA, FLJ93901, Homo sapiens Friend leukemia virus integration 1 (FLI1), mRNA (Friend leukemia virus integration 1, isoform CRA_a)

UniProt : B2R8H2, Q01543, UniProt ID: B2R8H2_HUMAN, FLI1_HUMAN,

cDNA, FLJ93901, Homo sapiens Friend leukemia virus integration 1 (FLI1), mRNA (Friend leukemia virus integration 1, isoform CRA_a)

Homo sapiens

MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQ
PVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTN
ERRVIVPADPTLWTQEHVRQWLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATT
LYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNK
SPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCI
TWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF
DFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS
QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93901, Homo sapiens Friend leukemia virus integration 1 (FLI1), mRNA (Friend leukemia virus integration 1, isoform CRA_a) contains a PF00178 domain.

cDNA, FLJ93901, Homo sapiens Friend leukemia virus integration 1 (FLI1), mRNA (Friend leukemia virus integration 1, isoform CRA_a) contains a PF02198 domain.

cDNA, FLJ93901, Homo sapiens Friend leukemia virus integration 1 (FLI1), mRNA (Friend leukemia virus integration 1, isoform CRA_a) is proteolytically cut by caspase () cleavage. SLFD-SAYG.