Putative uncharacterized protein

UniProt : P26323, Q544B3, UniProt ID: FLI1_MOUSE, Q544B3_MOUSE,

Putative uncharacterized protein

Mus musculus

MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQ
PVRVNVKREYDHMNGSRESPVDCSVSKCNKLVGGGEANPMNYNSYMDEKNGPPPPNMTTN
ERRVIVPADPTLWTQEHVRQWLEWAIKEYGLMEIDTSFFQNMDGKELCKMNKEDFLRATS
AYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLNVKEDPSYDSVRRGAWNNNMNSGLNK
SPLLGGSQTMGKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCI
TWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF
DFHGIAQALQPHPTETSMYKYPSDISYMPSYHAHQQKVNFVPSHPSSMPVTSSSFFGAAS
QYWTSPTAGIYPNPSVPRHPNTHVPSHLGSYY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00178 domain.

Putative uncharacterized protein contains a PF02198 domain.

Putative uncharacterized protein is proteolytically cut by caspase-3 (C14.003) cleavage. SLFD-SAYG.

Putative uncharacterized protein is proteolytically cut by caspase-3 (C14.003) cleavage. MEID-TSFF.

Putative uncharacterized protein is proteolytically cut by caspase-3 (C14.003) cleavage. SHTD-QSSR.