PMAP: SubstrateDB : cDNA FLJ77115, highly similar to Homo sapiens BCL2-associated X protein (BAX), transcript variant alpha, mRNA

cDNA FLJ77115, highly similar to Homo sapiens BCL2-associated X protein (BAX), transcript variant alpha, mRNA

UniProt : A8K4W1, Q07812, UniProt ID: A8K4W1_HUMAN, BAX_HUMAN,

cDNA FLJ77115, highly similar to Homo sapiens BCL2-associated X protein (BAX), transcript variant alpha, mRNA

Homo sapiens

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

cDNA FLJ77115, highly similar to Homo sapiens BCL2-associated X protein (BAX), transcript variant alpha, mRNA contains a PF00452 domain.

cDNA FLJ77115, highly similar to Homo sapiens BCL2-associated X protein (BAX), transcript variant alpha, mRNA is proteolytically cut by calpain-1 (C02.001) cleavage. FIQD-RAGR.