Polypyrimidine tract-binding protein 1

UniProt : P26599, UniProt ID: PTBP1_HUMAN,

Polypyrimidine tract-binding protein 1

Homo sapiens

MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRV
IHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPV
LRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQ
SPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLS
LDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLS
VPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGV
YGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREG
QEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGV
VKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Polypyrimidine tract-binding protein 1 contains a PF00076 domain.

Polypyrimidine tract-binding protein 1 contains a PF00076 domain.

Polypyrimidine tract-binding protein 1 contains a PF00076 domain.

Polypyrimidine tract-binding protein 1 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. AAVD-AGMA.

Polypyrimidine tract-binding protein 1 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IVPD-IAVG.

Polypyrimidine tract-binding protein 1 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. DAGM-AMAG.

Polypyrimidine tract-binding protein 1 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. LAAS-AAAV.