Putative uncharacterized protein

UniProt : A8K7B7, P30153, UniProt ID: 2AAA_HUMAN, A8K7B7_HUMAN,

Putative uncharacterized protein

Homo sapiens

MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF02985 domain.

Putative uncharacterized protein contains a PF02985 domain.

Putative uncharacterized protein contains a PF02985 domain.

Putative uncharacterized protein contains a PF02985 domain.

Putative uncharacterized protein contains a PF02985 domain.

Putative uncharacterized protein contains a PF02985 domain.

Putative uncharacterized protein contains a PF02985 domain.

Putative uncharacterized protein contains a PF02985 domain.

Putative uncharacterized protein contains a PF02985 domain.

Putative uncharacterized protein contains a PF02985 domain.

Putative uncharacterized protein contains a PF02985 domain.

Putative uncharacterized protein is proteolytically cut by caspase-3 (C14.003) cleavage. DEQD-SVRL.

Putative uncharacterized protein is proteolytically cut by caspase-3 (C14.003) cleavage. DEQD-SVRL.

Putative uncharacterized protein is proteolytically cut by caspase-3 (C14.003) cleavage. DEQD-SVRL.