Polypyrimidine tract binding protein 1 (Polypyrimidine tract binding protein 1, isoform CRA_c)

UniProt : Q9BUQ0, UniProt ID: Q9BUQ0_HUMAN,

Polypyrimidine tract binding protein 1 (Polypyrimidine tract binding protein 1, isoform CRA_c)

Homo sapiens

MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRV
IHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPV
LRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQ
SPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLS
LDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGAP
GIISASPYAGAGFPPTFAIPQAAGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGA
GNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHL
NGHKLHGKPIRITLSKHQNVQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSA
TLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNH
DLGENHHLRVSFSKSTI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Polypyrimidine tract binding protein 1 (Polypyrimidine tract binding protein 1, isoform CRA_c) contains a PF00076 domain.

Polypyrimidine tract binding protein 1 (Polypyrimidine tract binding protein 1, isoform CRA_c) contains a PF00076 domain.

Polypyrimidine tract binding protein 1 (Polypyrimidine tract binding protein 1, isoform CRA_c) contains a PF00076 domain.

Polypyrimidine tract binding protein 1 (Polypyrimidine tract binding protein 1, isoform CRA_c) is proteolytically cut by caspase-3 (C14.003) cleavage. LKTD-SSPN.

Polypyrimidine tract binding protein 1 (Polypyrimidine tract binding protein 1, isoform CRA_c) is proteolytically cut by caspase-3 (C14.003) cleavage. AAVD-AGMA.

Polypyrimidine tract binding protein 1 (Polypyrimidine tract binding protein 1, isoform CRA_c) is proteolytically cut by caspase-3 (C14.003) cleavage. IVPD-IAVG.

Polypyrimidine tract binding protein 1 (Polypyrimidine tract binding protein 1, isoform CRA_c) is proteolytically cut by caspase-3 (C14.003) cleavage. IVPD-IAVG.

Polypyrimidine tract binding protein 1 (Polypyrimidine tract binding protein 1, isoform CRA_c) is proteolytically cut by caspase-3 (C14.003) cleavage. LKTD-SSPN.

Polypyrimidine tract binding protein 1 (Polypyrimidine tract binding protein 1, isoform CRA_c) is proteolytically cut by caspase-3 (C14.003) cleavage. AAVD-AGMA.