cAMP-responsive element-binding protein 3-like protein 3

UniProt : Q91XE9, UniProt ID: CR3L3_MOUSE,

cAMP-responsive element-binding protein 3-like protein 3

Mus musculus

MDGDIAAGKMASPVCAMAPLDSMEVLDLLFDRQDGILRNVELAEGWILAREEQKVLLNSD
SDEFLNCILGPGDSDPSSPLWSPADSDSGISEDLPSDPQDTPPRSGTEPANTVARCHTRE
QGKGPCPSYLPSTPCPEPPRTQVQESSVAIDLDMWSTDTLYPEEPAGSPSRFNLTVKELL
LSGGSGDLQQHSLAASQLLGPGSGHCQELVLTEDEKKLLAKEGVTLPTQLPLTKYEERVL
KKIRRKIRNKQSAQESRKKKKEYIDGLENRMSACTAQNQELQRKVLHLEKQNLSLLEQLK
HLQALVVQSTSKPAHAGTCIAVLLLSFALIILPSISPFNSNKVDSPGDFVPVRVFSRTLH
NHAASRVAPDVTPGSEVPGPWPDVGTPHKGPSSGGLSADWGNFLEIPMLDNLTEELDNST
LVLANSTEDLGRATLLDWVASEPLLSPGRVGLEIPGEMWLSWVPRWLRVRLVQDALGVL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cAMP-responsive element-binding protein 3-like protein 3 contains a PF00170 domain.

cAMP-responsive element-binding protein 3-like protein 3 is proteolytically cut by site-1 peptidase (S08.063) cleavage. TCIA-VLLL.

cAMP-responsive element-binding protein 3-like protein 3 is proteolytically cut by S2P peptidase (M50.001) cleavage. SRTL-HNHA.