Sterol regulatory element-binding protein 2

UniProt : Q60429, UniProt ID: SRBP2_CRIGR,

Sterol regulatory element-binding protein 2

Cricetulus griseus

MDESSELGGLETMDTLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGGGSS
GSSSSSNSSSSSGSNSRGNGGAATDPGVQRSFSQVPLPTFSPSTASPQALALQVKVSPTP
PRATPVLQPRPQPQPQPQPSAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQ
AQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVL
VQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPLQTGALQVPTLVGSNGTILTTM
PVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDA
KMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSDVDLKIE
DFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRI
LLCVLTFLGLSFSPLTSLLQWGGAHDTDQHPYSGSGRSVLSLESGSGGWFDWMMPTLLLW
LVNGVIVLSVFVKLLVHGEPVIRPHTRSSVTFWRHRKQADLDLARGDFAAAAANLQTCLS
VLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWILKKVFQRWRATPATAAGFEDEAKSS
ARDAALAYHRLHQLHITGKLPAGSTCSDVHMALCAVNLAECAEEKIPPSTLIEIHLTAAM
GLKTGCGGKLGFLASYFLNRAQSLCGPEHSTVPDSLRWLCHPLGQKFFMERSWSIKSAAK
ESLYCAQRNPADPIAQVHQAFCKNLLERAVESLVKPQSKKKSGDQEDESCEFSSALEYLR
LLHSFVDSVGFVTPPFSSSSVLKSALGPDIICRWWTSAVTMAISWLQGDDAAVRSHFTEV
ERIPKALEVTESPLVKAVFYACRAMHASLSGKGDGQQNSFCHCERASGHLWNSLNVSGAT
SDPSLNHVVQLLTCDLLLSLRTALWQKQAGASQGLGETYHASGTELAGFQRDLGSLRRLA
HSFRPAYRKVFLHEPTVRLMAGANPTRTHQLLEHSLRRRTSQNTKHGEIDTWPGQRERAT
AILLACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCNDCQQMIVKLGGGTAIAAS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sterol regulatory element-binding protein 2 contains a PF00010 domain.

Sterol regulatory element-binding protein 2 is proteolytically cut by site-1 peptidase (S08.063) cleavage. RSVL-SLES.