Striatin, calmodulin binding protein

UniProt : B2RWV9, O55106, UniProt ID: B2RWV9_MOUSE, STRN_MOUSE,

Striatin, calmodulin binding protein

Mus musculus

MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEW
ARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLK
YGTELNQGDMKPPSYDSDEGNETEVQPQQNSQLMWKQGRQLLRQYLQEVGYTDTILDVKS
KRVRALLGFSSDVTDREDDKNQDSVINGTEAEVKETAMIGKSELTDSASVLDNFKFLESA
AADFSDEDEDEDTDGRAKSVIDTSTIVRKKALPDTSEDRDTKEALKEFDFLVTSEEGDNE
SRSAGDGTDWEKEDQCLTPEAWNVDQGVISKLKEQYKKERKGKKGVKRPNRSKLQDMLAN
LRDVDELPSLQPSVGSPSRPSSSRLPEQELSRADEVEALTFPPSSGKSFIMGADEALESE
LGLGELAGLTVANEADSLAYDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLIT
ASEDHTLKMWNLQKTAPAKKSTSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGRI
QSWSTTNPNVDPYDAYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTE
VAPALSVFNDNQELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRVLTLESNVDST
SSSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLY
LMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Striatin, calmodulin binding protein contains a PF00400 domain.

Striatin, calmodulin binding protein contains a PF00400 domain.

Striatin, calmodulin binding protein contains a PF00400 domain.

Striatin, calmodulin binding protein contains a PF00400 domain.

Striatin, calmodulin binding protein contains a PF00400 domain.

Striatin, calmodulin binding protein contains a PF08232 domain.

Striatin, calmodulin binding protein is proteolytically cut by granzyme B, human-type (S01.010) cleavage. NEAD-SLAY.

Striatin, calmodulin binding protein is proteolytically cut by granzyme B, human-type (S01.010) cleavage. KEFD-FLVT.

Striatin, calmodulin binding protein is proteolytically cut by granzyme B, human-type (S01.010) cleavage. AAAD-FSDE.