Homo sapiens

MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLP
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by caspase-3 (C14.003) cleavage..

is proteolytically cut by caspase-3 (C14.003) cleavage..

is proteolytically cut by myeloblastin (S01.134) cleavage. GKDC-RDGF.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. RSSA-SVPK.

is proteolytically cut by caspase-3 (C14.003) cleavage. DCRD-GFYE.

is proteolytically cut by caspase-6 (C14.005) cleavage. TDPA-VFTD.

is proteolytically cut by caspase-3 (C14.003) cleavage. QLQF-DDED.

is proteolytically cut by poliovirus-type picornain 3C (C03.001) cleavage. EFQQ-LLNQ.

is proteolytically cut by caspase-3 (C14.003) cleavage..

is proteolytically cut by myeloblastin (S01.134) cleavage. GKDC-RDGF.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. RSSA-SVPK.

is proteolytically cut by caspase-3 (C14.003) cleavage. DCRD-GFYE.

is proteolytically cut by caspase-6 (C14.005) cleavage. TDPA-VFTD.

is proteolytically cut by caspase-3 (C14.003) cleavage. QLQF-DDED.

is proteolytically cut by poliovirus-type picornain 3C (C03.001) cleavage. EFQQ-LLNQ.

is proteolytically cut by C-terminal processing peptidase-1 (S41.001) cleavage. QPYP-FTSS.