Caspase 9, apoptosis-related cysteine protease (Caspase 9, apoptosis-related cysteine peptidase, isoform CRA_a)

UniProt : P55211, Q53Y70, UniProt ID: CASP9_HUMAN, Q53Y70_HUMAN,

Caspase 9, apoptosis-related cysteine protease (Caspase 9, apoptosis-related cysteine peptidase, isoform CRA_a)

Homo sapiens

MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEV
LRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTR
TGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSG
SWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Caspase 9, apoptosis-related cysteine protease (Caspase 9, apoptosis-related cysteine peptidase, isoform CRA_a) contains a PF00619 domain.

Caspase 9, apoptosis-related cysteine protease (Caspase 9, apoptosis-related cysteine peptidase, isoform CRA_a) contains a PF00656 domain.

Caspase 9, apoptosis-related cysteine protease (Caspase 9, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-9 (C14.010) cleavage. PEPD-ATPF.

Caspase 9, apoptosis-related cysteine protease (Caspase 9, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DQLD-AISS.

Caspase 9, apoptosis-related cysteine protease (Caspase 9, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. PEPD-ATPF.

Caspase 9, apoptosis-related cysteine protease (Caspase 9, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by neprilysin (M13.001) cleavage. DQLD-AISS.

Caspase 9, apoptosis-related cysteine protease (Caspase 9, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by neprilysin (M13.001) cleavage. RPEI-RKPE.

Caspase 9, apoptosis-related cysteine protease (Caspase 9, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-9 (C14.010) cleavage. PEDE-SPGS.