cDNA FLJ45465 fis, clone BRSTN2012174, highly similar to 14-3-3 protein epsilon (14-3-3E)
|
UniProt : B3KY71, P62258, UniProt ID: 1433E_HUMAN, B3KY71_HUMAN, cDNA FLJ45465 fis, clone BRSTN2012174, highly similar to 14-3-3 protein epsilon (14-3-3E) Homo sapiens MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE EQNKEALQDVEDENQ The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
cDNA FLJ45465 fis, clone BRSTN2012174, highly similar to 14-3-3 protein epsilon (14-3-3E) contains a PF00244 domain.
cDNA FLJ45465 fis, clone BRSTN2012174, highly similar to 14-3-3 protein epsilon (14-3-3E) is proteolytically cut by caspase-3 (C14.003) cleavage. MQGD-GEEQ.