Actin, cytoplasmic 1

UniProt : P60709, Q1KLZ0, UniProt ID: ACTB_HUMAN, Q1KLZ0_HUMAN,

Actin, cytoplasmic 1

Homo sapiens

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Actin, cytoplasmic 1 contains a PF00022 domain.

Actin, cytoplasmic 1 is proteolytically cut by neutrophil elastase (S01.131) cleavage. HQGV-MVGM.

Actin, cytoplasmic 1 is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. SLEK-SYEL.

Actin, cytoplasmic 1 is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. DMEK-IWHH.

Actin, cytoplasmic 1 is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. NREK-MTQI.

Actin, cytoplasmic 1 is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. YLMK-ILTE.

Actin, cytoplasmic 1 is proteolytically cut by caspase-3 (C14.003) cleavage. ELPD-GQVI.

Actin, cytoplasmic 1 is proteolytically cut by caspase-1 (C14.001) cleavage. ELPD-GQVI.

Actin, cytoplasmic 1 is proteolytically cut by caspase-1 (C14.001) cleavage. LVVD-NGSG.