Isoform Alpha' of Caspase-7

UniProt : B5BU45, P55210, UniProt ID: B5BU45_HUMAN, P55210-3,

Isoform Alpha' of Caspase-7

Homo sapiens

MDCVGWPPGRKWHLEKNTSCGGSSGICASYVTQMADDQGCIEEQGVEDSANEDSVDAKPD
RSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVR
NGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEE
NVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDA
NPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVND
RVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform Alpha' of Caspase-7 contains a PF00656 domain.

Isoform Alpha' of Caspase-7 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. DSVD-AKPD.

Isoform Alpha' of Caspase-7 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IQAD-SGPI.