RRP15-like protein

UniProt : Q9Y3B9, UniProt ID: RRP15_HUMAN,

RRP15-like protein

Homo sapiens

MAAAAPDSRVSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDD
DAIEADSEGDAEPCDKENENDGESSVGTNMGWADAMAKVLNKKTPESKPTILVKNKKLEK
EKEKLKQERLEKIKQRDKRLEWEMMCRVKPDVVQDKETERNLQRIATRGVVQLFNAVQKH
QKNVDEKVKEAGSSMRKRAKLISTVSKKDFISVLRGMDGSTNETASSRKKPKAKQTEVKS
EEGPGWTILRDDFMMGASMKDWDKESDGPDDSRPESASDSDT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

RRP15-like protein contains a PF07890 domain.

RRP15-like protein is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VKPD-VVQD.