Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2))

UniProt : A8ASI8, P55957, UniProt ID: A8ASI8_HUMAN, BID_HUMAN,

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2))

Homo sapiens

MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTD
GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSE
EDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQ
NLRTYVRSLARNGMD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) contains a PF06393 domain.

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by caspase-15 (C14.038) cleavage..

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by caspase-8 (C14.009) cleavage. LQTD-GNRS.

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by caspase-15 (C14.038) cleavage..

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by caspase-8 (C14.009) cleavage. LQTD-GNRS.

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IEAD-SESQ.

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by caspase-15 (C14.038) cleavage..

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by caspase-8 (C14.009) cleavage. LQTD-GNRS.

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IEAD-SESQ.

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by caspase-8 (C14.009) cleavage. LQTD-GNRS.

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by caspase-2 (C14.006) cleavage. LQTD-GNRS.

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by caspase-1 (C14.001) cleavage. IEAD-SESQ.

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IEAD-SESQ.

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by calpain-1 (C02.001) cleavage. WEGY-DELQ.

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by caspase-3 (C14.003) cleavage..

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by calpain-1 (C02.001) cleavage. SRLG-RIEA.

Desmocollin type 4 (BH3 interacting domain death agonist, isoform CRA_d) (cDNA, FLJ94329, Homo sapiens BH3 interacting domain death agonist (BID), mRNA) (BID isoform L(2)) is proteolytically cut by caspase-10 (C14.011) cleavage..