Isoform 3 of Tissue-type plasminogen activator

UniProt : B2R8E8, P00750, UniProt ID: B2R8E8_HUMAN, P00750-3,

Isoform 3 of Tissue-type plasminogen activator

Homo sapiens

MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQGCSEPRCFNGGTCQQALYFSDF
VCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRP
DAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGT
HSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRL
TWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGIL
ISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDND
IALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEA
HVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMT
LVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 3 of Tissue-type plasminogen activator contains a PF00039 domain.

Isoform 3 of Tissue-type plasminogen activator contains a PF00089 domain.

Isoform 3 of Tissue-type plasminogen activator contains a PF00051 domain.

Isoform 3 of Tissue-type plasminogen activator contains a PF00051 domain.

Isoform 3 of Tissue-type plasminogen activator contains a PF00008 domain.

Isoform 3 of Tissue-type plasminogen activator is proteolytically cut by t-plasminogen activator (S01.232) cleavage. PQFR-IKGG.