Tropomyosin alpha-1 chain

UniProt : P58772, UniProt ID: TPM1_RABIT,

Tropomyosin alpha-1 chain

Oryctolagus cuniculus

MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tropomyosin alpha-1 chain contains a PF00261 domain.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. QAEA-DKKA.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. EERA-ELSE.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. TNNL-KSLE.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. NNLK-SLEA.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. KSLE-AQAE.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. KYEE-EIKV.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. RAEF-AERS.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. IDDL-EDEL.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. QAEA-DKKA.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. EERA-ELSE.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. TNNL-KSLE.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. NNLK-SLEA.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. KSLE-AQAE.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. KYEE-EIKV.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. RAEF-AERS.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. IDDL-EDEL.

Tropomyosin alpha-1 chain is proteolytically cut by calpain (C02.023) cleavage. QMLK-LDKE.