Notch homolog 2 N-terminal-like protein

UniProt : Q7Z3S9, UniProt ID: NT2NL_HUMAN,

Notch homolog 2 N-terminal-like protein

Homo sapiens

MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGE
DCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTC
TTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCD
SLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Notch homolog 2 N-terminal-like protein contains a PF00008 domain.

Notch homolog 2 N-terminal-like protein contains a PF00008 domain.

Notch homolog 2 N-terminal-like protein contains a PF00008 domain.

Notch homolog 2 N-terminal-like protein contains a PF07645 domain.

Notch homolog 2 N-terminal-like protein is proteolytically cut by neutrophil elastase (S01.131) cleavage..