Early 35 kDa protein

UniProt : P08160, UniProt ID: VP35_NPVAC,

Early 35 kDa protein

Autographa californica nuclear polyhedrosis virus

MCVIFPVEIDVSQTIIRDCQVDKQTRELVYINKIMNTQLTKPVLMMFNISGPIRSVTRKN
NNLRDRIKSKVDEQFDQLERDYSDQMDGFHDSIKYFKDEHYSVSCQNGSVLKSKFAKILK
SHDYTDKKSIEAYEKYCLPKLVDERNDYYVAVCVLKPGFENGSNQVLSFEYNPIGNKVIV
PFAHEINDTGLYEYDVVAYVDSVQFDGEQFEEFVQSLILPSSFKNSEKVLYYNEASKNKS
MIYKALEFTTESSWGKSEKYNWKIFCNGFIYDKKSKVLYVKLHNVTSALNKNVILNTIK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Early 35 kDa protein contains a PF02331 domain.

Early 35 kDa protein is proteolytically cut by caspase (insect 1) (C14.015) cleavage. DQMD-GFHD.

Early 35 kDa protein is proteolytically cut by caspase-7 (C14.004) cleavage. DQMD-GFHD.

Early 35 kDa protein is proteolytically cut by caspase-3 (C14.003) cleavage. DQMD-GFHD.