PMAP: SubstrateDB : cDNA, FLJ94334, Homo sapiens growth arrest-specific 2 (GAS2), mRNA (Growth arrest-specific 2, isoform CRA

cDNA, FLJ94334, Homo sapiens growth arrest-specific 2 (GAS2), mRNA (Growth arrest-specific 2, isoform CRA_a)

UniProt : B2R9C8, O43903, UniProt ID: B2R9C8_HUMAN, GAS2_HUMAN,

cDNA, FLJ94334, Homo sapiens growth arrest-specific 2 (GAS2), mRNA (Growth arrest-specific 2, isoform CRA_a)

Homo sapiens

MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEK
LDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWC
RDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLS
APSPSPSPSSKSSGKKSTGNLLDDAVKRISEDPPCKCPNKFCVERLSQGRYRVGEKILFI
RMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYL
VVSASYKAKKEIK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

cDNA, FLJ94334, Homo sapiens growth arrest-specific 2 (GAS2), mRNA (Growth arrest-specific 2, isoform CRA_a) contains a PF00307 domain.

cDNA, FLJ94334, Homo sapiens growth arrest-specific 2 (GAS2), mRNA (Growth arrest-specific 2, isoform CRA_a) contains a PF02187 domain.

cDNA, FLJ94334, Homo sapiens growth arrest-specific 2 (GAS2), mRNA (Growth arrest-specific 2, isoform CRA_a) is proteolytically cut by caspase-7 (C14.004) cleavage. SRVD-GKTS.

cDNA, FLJ94334, Homo sapiens growth arrest-specific 2 (GAS2), mRNA (Growth arrest-specific 2, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. SRVD-GKTS.