Putative uncharacterized protein

UniProt : Q3UIC2, UniProt ID: Q3UIC2_MOUSE,

Putative uncharacterized protein

Mus musculus

MCRIAGAPRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLPKDVHEGQPLLNVKF
SNCNRKRKVQYESSEPADFKVDEDGTVYAVRSFPLTAEQAKFLIYAQDKETQEKWQVAVN
LSREPTLTEEPMKEPHEIEEIVFPRQLAKHSGALQRQKRDWVIPPINLPENSRGPFPQEL
VRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAV
DINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTY
GLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDVIVANLTVTDKDQPHTPAWNAAY
RISGGDPTGRFAILTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQS
TATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTLTAQDPDRYMQQNIRYTKLSDP
ANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDIND
NAPQVLPQEAETCETPEPNSINITALDYDIDPNAGPFAFDLSLCSVTIKRNWTINRLNGD
FAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGL
GTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGE
EDQDYDLSQLQQPDTVEPDAIKPVGIRRLDERPIHAEPQYPVRSAAPHPGDIGDFINEGL
KSADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGDQDYDYLNDWGPRFKKLADM
YGGGDD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00028 domain.

Putative uncharacterized protein contains a PF00028 domain.

Putative uncharacterized protein contains a PF00028 domain.

Putative uncharacterized protein contains a PF00028 domain.

Putative uncharacterized protein contains a PF00028 domain.

Putative uncharacterized protein contains a PF01049 domain.

Putative uncharacterized protein contains a PF08758 domain.

Putative uncharacterized protein is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..

Putative uncharacterized protein is proteolytically cut by presenilin 1 (A22.001) cleavage..

Putative uncharacterized protein is proteolytically cut by presenilin 2 (A22.002) cleavage..

Putative uncharacterized protein is proteolytically cut by membrane-type matrix metallopeptidase-5 (M10.023) cleavage..