Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b)

UniProt : B0YIY6, P19022, UniProt ID: B0YIY6_HUMAN, CADH2_HUMAN,

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b)

Homo sapiens

MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKF
SNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVK
LSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQEL
VRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAV
DINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTY
GLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVY
RISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQS
TATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDP
ANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDIND
NAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGD
FAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGL
GTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGE
EDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGL
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADM
YGGGDD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b) contains a PF00028 domain.

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b) contains a PF00028 domain.

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b) contains a PF01049 domain.

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b) contains a PF08758 domain.

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b) contains a PF00028 domain.

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b) contains a PF00028 domain.

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b) contains a PF00028 domain.

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage..

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b) is proteolytically cut by gingipain R1 (C25.001) cleavage..

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage..

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b) is proteolytically cut by gingipain R1 (C25.001) cleavage..

Neural-cadherin (Cadherin 2, type 1, N-cadherin (Neuronal), isoform CRA_b) is proteolytically cut by matrix metallopeptidase () cleavage..