Protein UTH1

UniProt : P36135, UniProt ID: UTH1_YEAST,

Protein UTH1

Saccharomyces cerevisiae

MCFLLETSASPRSKLSKDFKPQFTLLSSVTKKKKKKVRPHNFQCIHSLNFVYFLFIHSFL
FEYNQLLVLPLNKNLPSLNFSRNSSMKLSALLALSASTAVLAAPAVHHSDNHHHNDKRAV
VTVTQYVNADGAVVIPAATTATSAAADGKVESVAAATTTLSSTAAAATTSAAASSSSSSS
SSSSSSSSVGSGDFEDGTISCSDFPSGQGAVSLDWLGLGGWASIMDMNGNTATSCQDGYY
CSYACSPGYAKTQWPSEQPSDGRSVGGLYCKNGKLYRSNTDTNSLCVEGQGSAQAVNKVS
GSIAICGTDYPGSENMVVPTVVGAGSSQPINVIKEDSYYQWQGKKTSAQYYVNNAGVSVE
DGCIWGTEGSGVGNWAPVVLGAGYTDGITYLSIIPNPNNKEAPNFNIKIVATDGSTVNGA
CSYENGVYSGSGSDGCTVSVTSGSANFVFY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein UTH1 contains a PF03856 domain.

Protein UTH1 is proteolytically cut by kexin (S08.070) cleavage. KKVR-PHNF.