cDNA, FLJ93411, Homo sapiens actin, gamma 2, smooth muscle, enteric (ACTG2), mRNA

UniProt : B2R7E7, P63267, UniProt ID: ACTH_HUMAN, B2R7E7_HUMAN,

cDNA, FLJ93411, Homo sapiens actin, gamma 2, smooth muscle, enteric (ACTG2), mRNA

Homo sapiens

MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM
TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD
LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKS
YELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
PEYDEAGPSIVHRKCF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93411, Homo sapiens actin, gamma 2, smooth muscle, enteric (ACTG2), mRNA contains a PF00022 domain.

cDNA, FLJ93411, Homo sapiens actin, gamma 2, smooth muscle, enteric (ACTG2), mRNA is proteolytically cut by granzyme B, human-type (S01.010) cleavage. LVCD-NGSG.

cDNA, FLJ93411, Homo sapiens actin, gamma 2, smooth muscle, enteric (ACTG2), mRNA is proteolytically cut by granzyme B, human-type (S01.010) cleavage. GQKD-SYVG.