cDNA, FLJ93806, Homo sapiens actin, alpha 2, smooth muscle, aorta (ACTA2), mRNA (Actin, alpha 2, smooth muscle, aorta, isoform CRA_a)

UniProt : B2R8A4, P62736, UniProt ID: ACTA_HUMAN, B2R8A4_HUMAN,

cDNA, FLJ93806, Homo sapiens actin, alpha 2, smooth muscle, aorta (ACTA2), mRNA (Actin, alpha 2, smooth muscle, aorta, isoform CRA_a)

Homo sapiens

MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93806, Homo sapiens actin, alpha 2, smooth muscle, aorta (ACTA2), mRNA (Actin, alpha 2, smooth muscle, aorta, isoform CRA_a) contains a PF00022 domain.

cDNA, FLJ93806, Homo sapiens actin, alpha 2, smooth muscle, aorta (ACTA2), mRNA (Actin, alpha 2, smooth muscle, aorta, isoform CRA_a) is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage..