C-C motif chemokine 20

UniProt : P78556, UniProt ID: CCL20_HUMAN,

C-C motif chemokine 20

Homo sapiens

MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDI
NAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

C-C motif chemokine 20 contains a PF00048 domain.

C-C motif chemokine 20 is proteolytically cut by cathepsin D (A01.009) cleavage. HPKF-IVGF.

C-C motif chemokine 20 is proteolytically cut by cathepsin D (A01.009) cleavage. FIVG-FTRQ.

C-C motif chemokine 20 is proteolytically cut by cathepsin D (A01.009) cleavage. ANPK-QTWV.

C-C motif chemokine 20 is proteolytically cut by cathepsin D (A01.009) cleavage. KQTW-VKYI.

C-C motif chemokine 20 is proteolytically cut by cathepsin D (A01.009) cleavage. WVKY-IVRL.

C-C motif chemokine 20 is proteolytically cut by cathepsin B (C01.060) cleavage. LSKK-VKNM.