Gp160

UniProt : Q74114, UniProt ID: Q74114_9HIV2,

Gp160

Human immunodeficiency virus 2

MAYKRNQLLIAILLTSACLIYCKRKQYVTVFYGIPAWRNASIPLFCATKNRDTWGTIQCL
PDNDDYQEIPLNVTEAFDAWNNTVTEQAIEDVWNLFETSIKPCVKLTPLCVAMKCDGNIT
STGNTTTSTRARITSEEIKENSSCISADNCPGLKEEEMVMCQFNMTGLERDKKKQYNETW
YSNDVVCKPNGNSTTNQTCYMNHCNTTVITESCDKHYWDSMRFRYCTPPGFALLRCNDTN
YSGFEPNCSKVIATTCTRMMETQTSTWFGFNGTRAENRTYIYWHSRSNRTIISLNKYYNL
TVHCRRPGNKTVVPITLMSGLVFHSQPINRRPRQAWCWFKGNWTEAMQEVKQTLVKHPRY
RGTNDTGNINFTAPGKGSDPEVAYMWTNCRGEFFYCNMTWFLNWVENKTGEKHNYVPCHI
KQIINTWHKVGKNVYLPPREGELTCNSTVTSIIANIDTDMNGTETNITFSAEVAELYRLE
LGDYKLVEITPIGFAPTTEKRYSSAHGRQKRGVFVLGFLGFLTTAGVAMGTASLTLSAQS
RTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLKDQALLNSWGCAFR
QVCHTTVPWVNDSLTPDWANMTWQEWEQKVRYLEANISQSLEQAQIQQEKNMYELQRLNS
WDVFGNWFDLTSWIKYIQYGVYIVVGIIVLRIVIYIVQMLSRLRKGYRPVFSSPPGYIQQ
IHIHKDLEQLAREETEEDVGSNVGDRFWPWPIAYIHFLIRLLIRLLTRLYNSCRDLLSRI
FLTLQPILQNLRDWLRASTAFLQYGCEWIQEAFQAFGRAAKETLTSACRSLWRTLGRIGR
GILAVPRRIRQGAELALL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Gp160 contains a PF00516 domain.

Gp160 contains a PF00517 domain.

Gp160 is proteolytically cut by () cleavage. TEKR-YSSA.