Beta-neoendorphin-dynorphin

UniProt : O35417, UniProt ID: PDYN_MOUSE,

Beta-neoendorphin-dynorphin

Mus musculus

MAWSRLMLAACLLVMPSNVMADCLSLCSLCAVRIQDGPRPINPLICSLECQDLVPPSEEW
ETCRGFSSFLTLTVSGLRGKDDLEDEVALEEGISAHAKLLEPVLKELEKSRLLTSVPEEK
FRGLSSSFGNGKESELAGADRMNDEAAQGRTVHFNEEDLRKQAKRYGGFLRKYPKRSSEM
ARDEDGGQDGDQVGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQENPN
TYSEDLDV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Beta-neoendorphin-dynorphin contains a PF01160 domain.

Beta-neoendorphin-dynorphin is proteolytically cut by (S9G.073) cleavage. GFLR-KYPK.

Beta-neoendorphin-dynorphin is proteolytically cut by penicillolysin (M35.001) cleavage. GGFL-RKYP.

Beta-neoendorphin-dynorphin is proteolytically cut by penicillolysin (M35.001) cleavage. YGGF-LRKY.

Beta-neoendorphin-dynorphin is proteolytically cut by gametolysin (M11.001) cleavage. YGGF-LRKY.