Isoform 2 of Presenilins-associated rhomboid-like protein, mitochondrial

UniProt : Q9H300, UniProt ID: Q9H300-2,

Isoform 2 of Presenilins-associated rhomboid-like protein, mitochondrial

Homo sapiens

MAWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKV
EPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQ
YESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVTGIIAANVLVF
CLWRVPSLQRTMIRYFTSNPASSVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTK
IPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGH
ELIWKNREPLVKIWHEIRTNGPKKGGGSK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Presenilins-associated rhomboid-like protein, mitochondrial contains a PF01694 domain.

Isoform 2 of Presenilins-associated rhomboid-like protein, mitochondrial is proteolytically cut by () cleavage. YKRS-ALIP.

Isoform 2 of Presenilins-associated rhomboid-like protein, mitochondrial is proteolytically cut by () cleavage. YKRS-ALIP.

Isoform 2 of Presenilins-associated rhomboid-like protein, mitochondrial is proteolytically cut by () cleavage. QKCG-FRKA.