DnaJ homolog subfamily C member 7

UniProt : Q99615, UniProt ID: DNJC7_HUMAN,

DnaJ homolog subfamily C member 7

Homo sapiens

MAAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPK
NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQ
RALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKI
LKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMA
PDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNR
GTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKT
KEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEV
QKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFS
FEASGPGNFFFQFG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

DnaJ homolog subfamily C member 7 contains a PF00226 domain.

DnaJ homolog subfamily C member 7 contains a PF00515 domain.

DnaJ homolog subfamily C member 7 contains a PF00515 domain.

DnaJ homolog subfamily C member 7 contains a PF00515 domain.

DnaJ homolog subfamily C member 7 contains a PF00515 domain.

DnaJ homolog subfamily C member 7 contains a PF00515 domain.

DnaJ homolog subfamily C member 7 contains a PF00515 domain.

DnaJ homolog subfamily C member 7 contains a PF00515 domain.

DnaJ homolog subfamily C member 7 is proteolytically cut by caspase () cleavage. AECD-VVMA.

DnaJ homolog subfamily C member 7 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. AECD-VVMA.