UV excision repair protein RAD23 homolog A

UniProt : P54725, UniProt ID: RD23A_HUMAN,

UV excision repair protein RAD23 homolog A

Homo sapiens

MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVP
IRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAARE
DKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERV
VAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQ
FQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGE
VGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNF
DDE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

UV excision repair protein RAD23 homolog A contains a PF00240 domain.

UV excision repair protein RAD23 homolog A contains a PF00627 domain.

UV excision repair protein RAD23 homolog A contains a PF00627 domain.

UV excision repair protein RAD23 homolog A contains a PF09280 domain.

UV excision repair protein RAD23 homolog A is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VEGE-VGAI.