MHC class I antigen

UniProt : B1PKY1, P04439, UniProt ID: 1A03_HUMAN, B1PKY1_HUMAN,

MHC class I antigen

Homo sapiens

MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQ
IMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQL
RAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL
SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSL
TACKV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

MHC class I antigen contains a PF00129 domain.

MHC class I antigen contains a PF07654 domain.

MHC class I antigen contains a PF06623 domain.

MHC class I antigen is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. VAAV-MWRR.

MHC class I antigen is proteolytically cut by presenilin 1 (A22.001) cleavage. AVIT-GAVV.

MHC class I antigen is proteolytically cut by presenilin 1 (A22.001) cleavage. LGAV-ITGA.